PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010921291.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 366aa    MW: 40950.1 Da    PI: 6.605
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010921291.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM184.13.4e-57161431129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdee++++yL +kv ++ +++  ++ +vd++k+ePwdLp+k+k +ekewyfF++rd+ky+tg r+nrat++gyWkatgkdke+++ 
  XP_010921291.1  16 LPPGFRFHPTDEEIITHYLSPKVLNHGFSA-IAVGDVDLNKCEPWDLPSKAKMGEKEWYFFCQRDRKYPTGMRTNRATEAGYWKATGKDKEIYRG 109
                     79*************************999.88***************99999****************************************** PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +g lvg+kktLvfykgrapkgekt+Wvmheyrle
  XP_010921291.1 110 RGILVGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 143
                     ********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-6312168IPR003441NAC domain
PROSITE profilePS5100558.64816167IPR003441NAC domain
PfamPF023655.6E-3017142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MVDAPVLNKG EDSIDLPPGF RFHPTDEEII THYLSPKVLN HGFSAIAVGD VDLNKCEPWD  60
LPSKAKMGEK EWYFFCQRDR KYPTGMRTNR ATEAGYWKAT GKDKEIYRGR GILVGMKKTL  120
VFYKGRAPKG EKTNWVMHEY RLEGKAPYSN LPKTIKDAWV VSRVFHKNIG IKKSPMLGLE  180
RMSSFGDDFL DSSTLPPLLD PPYYNSNIRP SPSYINDGEG FEFKGIPSSS SSMPSFYSSM  240
LGVENQQGIS PQASSGNQHQ NAVFYAQVPP QSPYFSLPEA PNLGYLHQDD AILRALGATN  300
DASSAIRRTC KVEQYSNQSM VSPSQDTGLS TDHNTEISSV VSKHYDDLDD PCSAGPVMDL  360
ENMWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-521417315171NO APICAL MERISTEM PROTEIN
1ut4_B4e-521417315171NO APICAL MERISTEM PROTEIN
1ut7_A4e-521417315171NO APICAL MERISTEM PROTEIN
1ut7_B4e-521417315171NO APICAL MERISTEM PROTEIN
4dul_A4e-521417315171NAC domain-containing protein 19
4dul_B4e-521417315171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921291.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_010921292.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-109NC100_ARATH; NAC domain-containing protein 100
TrEMBLM0T5A91e-173M0T5A9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P08600_0011e-173(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-102NAC domain containing protein 100